DPCstruct | MC20992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 16.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0AR66 | 3-116 | LSISQALHTYTLLTIGDGLVAQIPALLISISAGFIVTRVGGENKNLGFSIMNELLAQDFALLVTAVLAFIIGFLPGFPTPVFLILSA… |
| A0A379WN02 | 69-170 | MDLSSALSTYTMLTIGDGLVAQIPALLIAISAGFIVTRVNGDSDNMGRNIMTQLLNNPFVLVVTAILTISMGTLPGFPLPVFVILSV… |
| A0A6N8VSN3 | 5-123 | None |
| A0A149VG55 | 2-86 | None |
| A0A6I1ZJH2 | 1-111 | None |
| T0DUK7 | 69-177 | None |
| A0A447MTD7 | 1-147 | None |
| A0A090STR5 | 1-123 | None |
| A0A377KBB7 | 67-160 | None |
| A0A090QYF9 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.