DPCstruct | MC20991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 131 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518GHL6 | 1-126 | MVLICPEQCRMSGQASQLIERLLNDPAIPLEEVCYVSLAESMSGGGGPACLRLRLPVEVDQLSQLNPGCRVDRALENALTEAIELWY… |
| A0A4U9U819 | 258-392 | SQILTKADGKMMIVVPEESRQHPGVWHYLSEMVASGGPIDEIKVFDLRESMRNGGGPACLRLRVALNEAELRAVNPRVMMNDTLFTT… |
| A0A7H4ZJ93 | 24-157 | None |
| A0A377LG45 | 81-214 | None |
| A0A447XEW0 | 1-116 | None |
| A0A2E9MWF4 | 182-317 | None |
| A0A5I3FD05 | 368-502 | None |
| Q08MJ0 | 70-192 | None |
| A0A812QJL9 | 204-320 | None |
| A0A2X2II63 | 459-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.