DPCstruct | MC2099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 43 ± 3 aa |
| Standard deviation of domain lengths | 2.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.13 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 68.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495AEA9 | 3-43 | YLTFKCPSCGGSQYRTSPYDVRETNPHGAVCIFCKSGMHAL |
| A0A857SFE0 | 9-52 | ITIRLYFKCPCCSSSQYRASQFDVTVNNPHGTKCIFCKSVMTAQ |
| A0A291E541 | 5-55 | None |
| A0A850EYJ5 | 2-42 | None |
| A0A2T7AWG3 | 14-53 | None |
| A0A827PNZ5 | 1-42 | None |
| A0A6C2DNH8 | 12-55 | None |
| A0A3E2KPM1 | 1-42 | None |
| A0A2P5INK0 | 1-45 | None |
| A0A200L5Z4 | 16-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.