DPCstruct | MC20988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09969 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A117SW29 | 5-109 | RRAFTVDEANTVINEIRPILGGLMEAYRSGNLATIHEQSMWLIKLSRRLGFMINTRLGIVHFPTLYRGSYRVVLCYRYGEPRVMYWH… |
| A0A518G8H5 | 2-119 | LPLVRSIATDIAEVFRNVTGRRTDLHRLFRKGTTLSSGPLYDDELAESRADLQEEYEKIWRYRAELESLGVFLRQTEEGGIEFPTIV… |
| A0A534WT06 | 78-217 | None |
| A0A3M1BSP2 | 61-195 | None |
| A0A382MMM2 | 2-104 | None |
| A0A2D6PUW7 | 20-153 | None |
| A0A7V2UUN0 | 3-112 | None |
| A0A832ZW27 | 1-110 | None |
| A0A7C1T343 | 5-142 | None |
| A0A838F4P3 | 5-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.