DPCstruct | MC2098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 11.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G7WKM1 | 2-97 | GKGGGGGSTPRLLDDNLKNKQFLNVIDLVSEGPIEGPVGGMSGFLLNGTPVVDEEGNPNIHGVEVQWRAGTPTQEPLEDFPLCRKRN… |
| A0A6D0TX52 | 1-89 | MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSVLLNSTPVLDSEGNTNIAGVTVVFRAGEQEQTPPEGFESSGSE… |
| A0A830WJS1 | 1-81 | None |
| A0A7W4N151 | 1-109 | None |
| A0A377DL50 | 1-71 | None |
| A0A6L5VP66 | 1-81 | None |
| A0A1U9JY47 | 10-108 | None |
| A0A378N0X9 | 4-100 | None |
| A0A827H6B6 | 1-81 | None |
| A0A656H682 | 8-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.