DPCstruct | MC20979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 253 ± 29 aa |
| Standard deviation of domain lengths | 28.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A6RAY4 | 2-225 | QHDLEAQRYIDDQLIVRRAQAREEEEAEKEHEKRIREKIETERTRKEAEEAERREYEAKLKKQAVDEYNRIEAEKKQKEKKDKEKAD… |
| F2Q322 | 1-274 | MEMQEMGRLEKRPERDEHPLTRRDIEKEIQFERLKKMESDELARRKMEDALLIERMKALEKEREEKERERKIREKVQAEIAQKEKDE… |
| A0A163K073 | 636-886 | None |
| A0A177DPS4 | 466-733 | None |
| C4JTM5 | 245-445 | None |
| H0EX75 | 146-371 | None |
| A0A6A6AKF3 | 697-965 | None |
| C9SJW4 | 1-282 | None |
| Q0CT65 | 248-494 | None |
| A0A0G4PBS7 | 639-872 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.