DPCstruct | MC20977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 171 ± 43 aa |
| Standard deviation of domain lengths | 43.28 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0HBG8 | 220-421 | GEKGTKAPDKSISPFKAFTISAASRVGTGNVAGVAVAITLGGPGAVFWMWMIAILGGATAFIEATLAQLYKTRDYAANAYRGGPAYY… |
| M6TCF0 | 3-174 | GSALALMIGGPGVLFWIWISSFFIMPLRFVSSTLAIRFRTKTVSGRYLSGPMYFIESALKARWLAVGFATVGLLTVLVMGGAVPMLY… |
| A0A7Y3U935 | 63-256 | None |
| A0A0U3NS52 | 3-243 | None |
| T0CP65 | 27-184 | None |
| A0A0K2QZ80 | 121-332 | None |
| A0A447LTP1 | 106-214 | None |
| A0A1U7EE60 | 88-222 | None |
| R5QK67 | 69-260 | None |
| A0A447U623 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.