DPCstruct | MC20974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 116 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A826FT67 | 350-496 | FNMGFSVAHMACYLSLHLNHKNIIFIGQDLAYAENGNSHPDDYQNSANYESQMYEHILTEAYGGKEKIKTHHVWLMFKRNLEQDVQK… |
| M6T0N3 | 1-142 | MEARNILLVGQDLSFPNKLAHCKGAVLEERLNHIESRKLRREYHNHKQMTALPVKKAASIQGGEIRTNEKLLIFKKWFEEHPKKNPW… |
| A0A3R6M8A7 | 249-378 | None |
| A0A525C0R0 | 32-179 | None |
| A0A7C6NZR4 | 370-468 | None |
| A0A6H6EKZ4 | 94-204 | None |
| A0A6L1XIN1 | 1-148 | None |
| A0A7W1CGU9 | 351-475 | None |
| L8A3T5 | 368-461 | None |
| A0A5L8LPP2 | 12-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.