DPCstruct | MC20970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2FIC5 | 329-401 | PRLLDDASRTLVTPYRLGGRVYDLARALADRHGRSWRYLGRDGEDGMPLLALSGTDGPPMPLGTLVATHGPLT |
| A0A7W7LPS9 | 31-117 | FYEIDGTVFDLGRTFVDVTGGRWQWTGCRDDRSVPLMDFLKHPGDHRDMTVAEREPVPLDEVQRWFGPLIPEPARLTAADYQRALLA |
| A0A4Q1RN10 | 30-104 | None |
| A0A0N0NCY9 | 173-237 | None |
| A0A5C8QM32 | 176-255 | None |
| A0A7Z6TQL7 | 234-303 | None |
| A0A6I5MIY0 | 116-182 | None |
| A0A498BC91 | 203-279 | None |
| A0A2T7JW67 | 1-78 | None |
| A0A1I1HCI5 | 105-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.