DPCstruct | MC2097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8WT99 | 6-88 | AIYTKSGWAASIQASATHFSIPRSNSGPWTHVEIAFPSAEEPLIKEFAEDWYKPLDTVYGYVPAGIIAAIIIKHGGIKSGELP |
| A0A7G7WKH8 | 16-100 | LCKRVHCNDGYYVSIQASYGHYCSPRQDLPSYDLYDSYELGFPSEDDQLINAYAECDDCFTETVYPYVPKEVVIALIEKHGGVKV |
| A0A1Z8T8U6 | 3-88 | None |
| A0A1Q4W8L7 | 15-107 | None |
| A0A2E8RHT3 | 3-89 | None |
| A0A2D6XG54 | 1-99 | None |
| A0A1B9KHR7 | 10-103 | None |
| A0A133ZST8 | 150-244 | None |
| A0A382YWG5 | 14-105 | None |
| A0A849Y0E8 | 122-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.