DPCstruct | MC20967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 339 ± 54 aa |
| Standard deviation of domain lengths | 53.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6JWK5 | 1-300 | MADITHRSRRESARTRTKKKKKKGGEDDRFGLMKEQHTKQEKKKKKKKKKEKKEKKIHLLQTQGQPALLIVSVPLPYPEGQEEQQEQ… |
| U6H1Z2 | 3-314 | EDEVSIVEGCLELEEEMGVLGERAISISEGDSSGRVAELEAMLSAAAKESVMQGGLGTDLQVQEQEPEEQESDMPVGDTRDPPNTEQ… |
| U6JUW3 | 1-433 | None |
| U6KIU1 | 2-235 | None |
| U6KCD8 | 7-365 | None |
| U6K4W1 | 186-463 | None |
| U6K3X5 | 120-493 | None |
| U6JWF8 | 1-268 | None |
| U6JTW8 | 1-341 | None |
| U6GUI2 | 1-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.