DPCstruct | MC20966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 229 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9Z729 | 680-908 | MQQAGTSVYKVEDMEFGRRLAVEKELELPGPDGKIPGAWINAVWDESGAFVLYPTLLGIKVVNTVTNRVVRLLGKDETVRWINLSLY… |
| A0A2Y9PZ97 | 250-472 | MRQQLPDMEFGRRMAVERELEKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAAT… |
| A0A0P1ALK8 | 710-940 | None |
| A0A0E9NB17 | 966-1186 | None |
| A0A0K0JR80 | 567-797 | None |
| W7K9F2 | 296-530 | None |
| A0A822D142 | 1-222 | None |
| A0A7S4E4Q0 | 42-274 | None |
| A0A7R9BEF8 | 318-548 | None |
| A0A2G9U264 | 9-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.