DPCstruct | MC20963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M4FSY5 | 389-462 | TESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD |
| A0A0A9KZS3 | 1-64 | MKDDRQFTYDETVQIAISALQSVLQEDFKATEIEVGVVSKEDRIFRALSTEEIDQHLTAISERD |
| A0A843U919 | 373-447 | None |
| A0A6A2YQ09 | 128-200 | None |
| A0A166J8Q2 | 167-238 | None |
| A0A016W0L8 | 4-75 | None |
| A0A444G2Q3 | 45-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.