DPCstruct | MC20962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 58.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287TR35 | 1-54 | MPHAISVTPEEQEAIGRLEAMGFERARVIEAFFACDRNEQLAANYLLEHAGDEE |
| A0A6I9QHC6 | 250-305 | EEDDMHHAISATPEEEEAIGRLEAMGFDQALAIEAFLACDRNERMAANYLLEHAGD |
| A0A484KWT6 | 490-543 | None |
| A0A0P0WUW7 | 104-160 | None |
| A0A7G2ELJ1 | 655-708 | None |
| A0A2H1C788 | 38-97 | None |
| A0A0H1BL40 | 39-99 | None |
| A0A834ERU0 | 60-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.