DPCstruct | MC20961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 108 ± 23 aa |
| Standard deviation of domain lengths | 23.36 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VPF8 | 140-255 | VNEAAGFFLGLFERDATLRGYYERSHKEGEFLCMGCVGMSVKRGGSRRFRDCASLVRHARAATRCGRLQAHRALAGVVCRVLGWNIK… |
| A0A803N9Z9 | 3-81 | VFEEQEELRGYYKKNCENGEFYCLVCGALAGKLSRKYKNCVAVVQHSVTISSTKKRKAHRAFGHVICKILGWDVHRLPS |
| A0A804I569 | 214-363 | None |
| A0A1U7VDS7 | 157-256 | None |
| A0A0R0JS01 | 241-339 | None |
| C5YT82 | 23-100 | None |
| A0A453FJU4 | 44-138 | None |
| A0A835EN55 | 170-286 | None |
| A0A445JJN1 | 139-225 | None |
| A0A6A2YHY6 | 138-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.