DPCstruct | MC2096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5V8N3 | 3-117 | VLHVLRALSGLHAVAICLQPVFAGIYLNGSPGGLRMHEPIGHALAYLGLAQLLAATIWWRKGGRWTGPAVSLLILAGEAVQIAMGYS… |
| A0A1H0U7U2 | 2-128 | HALAVLVQVVVAGSYLDGSGKAMVVHGSVGLSAVFLAVAQLIAAVLFWRPGRGGLWPTGVAALLLAANGLEVGLGYTRSLAIHVPLG… |
| A0A4R7MGP9 | 1-131 | None |
| A0A5M3XYD9 | 44-159 | None |
| A0A438M7Y9 | 103-215 | None |
| A0A558A9Z3 | 11-126 | None |
| A0A345HQ80 | 2-124 | None |
| A0A4R7MGU8 | 11-127 | None |
| A0A7K3DA04 | 3-109 | None |
| A0A7G9S4C0 | 11-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.