DPCstruct | MC20959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 162 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9K9N0 | 4-175 | GNPSVYSDHLWASAFLVFGFKSEPPAVQLKAVDMVLFIKKTALPLAIDSFMTFSRCGSALELLKVCTNILEEVEKTYASRMQDWNRG… |
| A0A251RZR4 | 1-139 | MVLFIKKTALPLAIKAFTTFSRCNSSLELLKVCTNVLEEVEKSFVSQIQDWCHGSLCWKNKMSSHQRIDEYVWQDVTLLKATLLETR… |
| A0A6V7QVY7 | 225-397 | None |
| A0A7J6WR32 | 62-232 | None |
| A0A1D6QKE5 | 843-1013 | None |
| J3N960 | 283-427 | None |
| A0A392MC97 | 398-563 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.