DPCstruct | MC20958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 67.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YGW1 | 46-139 | MPCRGGYFIGNVSPARMDFRWFALGNCVAILSSLATPEQSVAIMDLIESRWEELVGEMPLKICYPAIESHEWRIVTGCDPKNTRWSY… |
| A0A0A9K9A5 | 2-87 | DFRFFSLGNLWSIVSSLATPRQAEGILNLIEAKWDDIVAIMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTPA |
| A0A6A2YY05 | 205-291 | None |
| A0A2N9GNT4 | 240-346 | None |
| A0A835U9V1 | 2-85 | None |
| A0A803M878 | 129-201 | None |
| A0A3S3PN75 | 112-226 | None |
| A0A7C8YTL9 | 43-122 | None |
| A0A4S8JCZ2 | 903-996 | None |
| A0A1J6KGT4 | 15-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.