DPCstruct | MC20957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 101 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 93.54 |
| Assigned Pfam label(s) | CL0197- CL0167- CL0149- PF00445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0JMA4 | 1-103 | MNRGFPSSCGCGGRITTFTSGTQDNPGRPFYRCETRGEDHLFKWVEEAMLEELEDVLPKVEVHETEIAKMKSEIEELMEVALNNKIE… |
| A0A445HAE1 | 4-109 | SSSSYTSKARSRVFCLCNIEAPLVTSWTEENPGRRFYGCGLYKDRGTKGCNFFQWHDPVDNNRQKKIIVGLMKEVDELKLREKDLQT… |
| A0A5N6PE42 | 324-429 | None |
| A0A396I5Z5 | 2-113 | None |
| A0A396IE27 | 49-156 | None |
| M4DH41 | 24-170 | None |
| A0A5A7RG01 | 143-245 | None |
| A0A6P5N5S5 | 7-131 | None |
| A0A443N3T9 | 51-208 | None |
| A0A058ZS48 | 49-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.