DPCstruct | MC20954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3WWX3 | 8-89 | MYNRPISPHLTIYNAQIFSIFSIWHRISGIFLSIFLYLSLISYKLFITLLSINFFFKLIIMITLLLLFYHSLNGLRSYFIQI |
| A0A8B0KEX2 | 1-104 | MLTNRPLPPHLTIYKPQLTSTFPISHRISGAFLATMVLFSPLLCPKMGLISFTYENFYQSSPSLPKFILSAVDLTTLALCYHMSNGV… |
| A0A2P5BAD3 | 132-225 | None |
| A0A7J6WCH7 | 112-216 | None |
| A0A4D6LH01 | 277-364 | None |
| A0A889Q410 | 1-92 | None |
| A0A7J6XEI4 | 68-162 | None |
| A0A6A3B467 | 89-185 | None |
| I3SJ95 | 128-218 | None |
| A0A0K9RTV3 | 108-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.