DPCstruct | MC20952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9YW58 | 1-82 | MLEGVKAISFKDVNHDGYSDIVIIGEYITGAGPQGVVPFPIADIYFQKKNKTFTTLPALDQALNDQGHNQTIKDVIQYVSKQ |
| U9W7P7 | 3-77 | AVAFEDVNSDGAGPDIIVIAEYMTGIGPTGAQPVPVATVFFNDGYDYFATNSSIDELLSSRGVETIEDVRTTSKE |
| A0A5D0CJK9 | 292-380 | None |
| A0A1L9QTT2 | 18-98 | None |
| A0A0P9HLB5 | 40-124 | None |
| Q08PD8 | 66-154 | None |
| A0A1G6F6C3 | 128-208 | None |
| E0RK41 | 167-253 | None |
| A0A3E4TWR0 | 146-230 | None |
| H6CR47 | 532-616 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.