DPCstruct | MC2095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 131 ± 16 aa |
| Standard deviation of domain lengths | 15.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2DUX3 | 95-232 | ACYTGDDFNYPGLIAGDEHGHSEALLGIFDAIAPVAAAALRHLDDGDRTGFHARLDPTVPLSREIFRAPTRHYKTGVVFLAYLNGHQ… |
| A0A424KUW7 | 1-133 | MPEGRPVEFDGRTVSIGDFSHALLGIFDAIAAPAALALHRLSQGDRSGFDRIMAPCELLGQKIFESPTRHYKTGLAFLSWLNGFQPN… |
| A0A2D6HBB0 | 229-380 | None |
| A0A2E5YG50 | 326-473 | None |
| A0A061NBR9 | 58-195 | None |
| A0A0K2R3Q2 | 163-291 | None |
| A0A6M8W5U0 | 4-111 | None |
| A0A800BCE6 | 1-101 | None |
| A0A7J6ZBI4 | 716-851 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.