DPCstruct | MC20946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7QHP7 | 4-109 | ISAEHLQALRSAIVDKPPYCSGICPVAQDNFLLYYTTNGNDARRIDFAKATDEELRHLAEACAPATFGRNSEDVLDDSYRKAGKLDK… |
| A0A5C3QR30 | 2-134 | NSQNKATFSFPESMEINIDALQCALSIRPPVTSGTVSVPSDQCVFYYDLQDGQARKPNFSNVSSAEVADLVDACQPATFGRNDEDVL… |
| A0A2J6T8V2 | 13-131 | None |
| A0A5C3PM27 | 3-103 | None |
| A0A4Y9ZNB5 | 1-126 | None |
| A0A3M7DV89 | 1-139 | None |
| A0A2A9NKJ2 | 1-109 | None |
| A0A2A9NBW9 | 120-241 | None |
| B8MXJ0 | 90-237 | None |
| A0A4V4JY62 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.