DPCstruct | MC20944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067M119 | 249-332 | FPYPRQYHSPSNHTAHPFKYHWAVPEKLIFYGETDDRRPICIKFARAYSKDAHQACVSLNCAPALLGFDILPGGWHMVVMDRLD |
| A0A5C3QQQ2 | 2-122 | LQGYYRTLESPTPSLQPECMHPRFFPHITSYSSQDTGEVVEFVYVKPLQPEWAIRCVCFEAVIPKTAERIVVKFAESKYGEGAHRYM… |
| A0A0K6GCK5 | 368-478 | None |
| A0A1C7LLL4 | 65-172 | None |
| A0A1C7LLJ3 | 413-496 | None |
| A0A409WUQ0 | 987-1090 | None |
| A0A6A4HXF3 | 141-250 | None |
| A0A0B7G160 | 357-475 | None |
| A0A2Z6RVH4 | 121-223 | None |
| A0A1B7MVH9 | 78-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.