DPCstruct | MC20938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284S134 | 179-294 | QQRLIFEGKQLEDGCLLSEYGIKNEATIPLVLRLPGGKPVIYLFTPLPLTAVVRLSLVKSWSFSAVYPGVPIKSSEAGQSTEWNVNT… |
| A0A5C3Q3F4 | 1-134 | MYYDGDRLDPDDTLVDIDAEDGDRLVLRHQQIGGKPVIYLSSLTELTAKVRLDLVSQWELSAIYPVVHIVHKPSERLHETIEWDVRT… |
| V2WVS7 | 605-725 | None |
| A8I6H9 | 434-585 | None |
| L8WRI9 | 974-1096 | None |
| A0A550BS52 | 223-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.