DPCstruct | MC20936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 374 ± 47 aa |
| Standard deviation of domain lengths | 47.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9YEK2 | 2-351 | EFVDDYAVLRWETDRGGFGLAYALHDGNGSVHGARRALRQRHRDHVGARYACVAVAMAATQVSNPYVPKLVACDMDEGAHQYETTWA… |
| A0A543AW45 | 26-347 | QRIPSAIAQHWVTENGSIALVFPDQNYIYSTVRPYWIKALPDVDAIVVVALDFDDTGPALFAYQQSTQATTEPRWPALARALGRAAP… |
| A0A1Q8LGG1 | 67-395 | None |
| A0A343VRB7 | 105-550 | None |
| A0A081HTW6 | 101-478 | None |
| A0A1N6BP88 | 225-661 | None |
| A0A2N8NZE2 | 113-438 | None |
| B5GQY7 | 277-681 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.