DPCstruct | MC20927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 371 ± 66 aa |
| Standard deviation of domain lengths | 65.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16483 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A127PCA1 | 90-449 | LTTFNLVNGTRGAYPDSQVYWAIIGKDWNSGRFVYVDTGGNLIPMGIGDNGALNKNGQGYTNYFHSLAQGKSVTIPPINSARLLLSV… |
| A0A7K0KRC6 | 7-353 | NQIYVTTLGQTSPGQWSYLRSDGSTAPINHLGAFATDHLTKNGQSYPNMSIRLDQAQGLTLPARFEGARMYVSLGAPLYIPISADDR… |
| A0A399Y1W1 | 196-595 | None |
| F2JV01 | 177-618 | None |
| A0A2M9JYV4 | 54-333 | None |
| A0A2V1CQZ7 | 67-448 | None |
| A0A395IPI5 | 5-275 | None |
| A0A259MTF1 | 2-427 | None |
| A0A0W0Z5L2 | 23-442 | None |
| A0A413RAL1 | 731-1077 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.