DPCstruct | MC20925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Standard deviation of domain lengths | 13.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0A6C1 | 27-112 | AGLLGATYSSHQMTYDLRRLRLNGLIRRLEHSNTYVLRVALFYTKVHDRLLAPLLAADRPPAPPPLRAALRVVDSTVDDYIDHARL |
| T1C8A1 | 24-122 | LAPLLGLDPSDMTAGRMTYDLRRLRLHQIIERVPHTNRYQVTSFGLEVAMFFTRTYNRLLRTGLSQICDPVPIDTPLRHHFDRLEGA… |
| A0A3D5DYQ3 | 110-235 | None |
| A0A6L7WRQ8 | 49-145 | None |
| A0A2S9XRA5 | 2-100 | None |
| A0A498P698 | 83-204 | None |
| A0A7Y8M019 | 236-360 | None |
| A0A2V9X0N6 | 1-84 | None |
| A0A7V0UIU3 | 215-312 | None |
| A0A2M7A873 | 76-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.