DPCstruct | MC20923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1CG79 | 534-603 | AEATITGSITGTTLTVTAWSGIPLRVGQKLFGNVIDALTEIKALDGTGTGGLGTYTVSKSQNAGSDTIKV |
| A0A225EC50 | 144-213 | PTTSFTGTISTTTLTVSAVSAGQLAVGQLISGTGVTPGTRITALGTGTGYTGTYTISVSQTVGSATAMTA |
| A0A117UZG4 | 207-276 | None |
| A0A4R2SRX9 | 444-512 | None |
| A0A1C2DS74 | 451-526 | None |
| A0A6S6PTK5 | 570-667 | None |
| A0A4Q1S9F8 | 339-416 | None |
| A0A1Y0YBQ2 | 332-410 | None |
| A0A2N3DB86 | 98-173 | None |
| H1SDI3 | 397-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.