DPCstruct | MC20920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7W7F9 | 2-88 | NRIETSGDVHYRCHVGHVYSPSSLVADQEQAGESALWQAVALLEEQAVVHHEMALRAARAERRAEERAHVQAALDARRAAAAVKALI |
| A0A2T0SJR2 | 34-138 | TPPAGFGCPSCGGSLFQVGGGPVPRYRCRVGHAWSPESLLDEQAVALEGALWMALRALEEKSALSRRMATAGAHRQSASADRFNDMA… |
| A0A1E4DNK0 | 6-114 | None |
| A0A536I177 | 43-172 | None |
| A0A0D3LA92 | 100-202 | None |
| A0A840GVY5 | 133-234 | None |
| A0A679HM71 | 1-106 | None |
| A0A7Y9LKT8 | 111-211 | None |
| A0A5C6YNU7 | 8-105 | None |
| A0A420XQF3 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.