DPCstruct | MC2092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.90 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0023- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3EPA2 | 124-259 | LIAKVSYPEEEPGAPKNTIKAMMRTLLVMTRELAQNNPLFTEEMKLTMLNVNEPGKMADFVCSILNLEKEEYQSVIESNILKERIEK… |
| A0A6N2CDK1 | 3-113 | ITMFITIQYSNFLKLQHIGDFNYARLADFGAAISGANQLQCQQVLEELDVHKRLQLTLEIVKKEMEISKIQESIAKAIEEKISGEQR… |
| A0A5B7IBT0 | 13-145 | None |
| A0A2V5UXJ5 | 4-136 | None |
| A0A0N1PKJ3 | 58-184 | None |
| A0A3Q0ILC2 | 418-547 | None |
| A0A1X7U1M0 | 31-156 | None |
| A0A1X7TQW5 | 79-162 | None |
| N1UIF1 | 1-103 | None |
| A0A812T9W3 | 12-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.