DPCstruct | MC20915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6PL57 | 414-533 | GLRTPAEIAKMIIEAGVTPTSIIVVWHQSTMDLDLLRELIESTGYYNVLPPKVNCIPMIPQFRENLPRKFTAKLDILFPLLFAGHHL… |
| A0A0D2FEN6 | 17-138 | NIDSMTVHQVAQKLKQTVIHPGTIILVWAVNIGDLRMLRNFLASAGYFDILAPDENCIPLIHVLGPNLPKIGQSQIPPRLEVLFPIK… |
| A0A2H3TQ19 | 325-449 | None |
| J4KKR6 | 450-587 | None |
| A0A1V6PBZ6 | 107-241 | None |
| A0A0D2GJW8 | 32-150 | None |
| A0A0D2IK98 | 137-258 | None |
| A0A101MKJ8 | 185-314 | None |
| A0A4Q4W9S2 | 289-413 | None |
| A0A428SS55 | 408-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.