DPCstruct | MC20914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 257 ± 34 aa |
| Standard deviation of domain lengths | 34.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447BYM4 | 1-253 | MTTVHAVTATVTQLTTTTVSVCAAPTNAGIYKRSALDVRSKKHPRALRTWGCEPGFVCNQPKPDGCNLWAEAPGLDFECHPDWCVPA… |
| A0A179HIZ7 | 369-597 | VTLCPSPTGATKPLPTDSDLTFGCKPGYVCNPPKPKGCNLWPDPPSKDYVCNPQECIPAPAFKKVTWPPNETSYYPPQDGYFNLNPE… |
| A0A2C5Z9W1 | 285-510 | None |
| A0A370TFQ2 | 456-677 | None |
| A0A167TQB3 | 231-531 | None |
| A0A2P4ZN14 | 1-293 | None |
| A0A072PTR5 | 1-224 | None |
| A0A167XGZ1 | 1-314 | None |
| W9XGK2 | 1-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.