DPCstruct | MC20913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 368 ± 50 aa |
| Standard deviation of domain lengths | 49.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2DS66 | 1-389 | MDSAPALQPTGGSPIDLSKDFEFRLEFDVEEDIEGELEHFVQLARYGLTRTARGYFQQTLSTHLGLFPVLAEYAEFLVSEDAYDELL… |
| A0A2V5HCT8 | 20-342 | LPLEENLEKEIEHFARLSRLGEYGEAQSYFDCTLRQHVDFFPVIAEYADMLVQQGAFKALYQFIDSRLKTFAERVEDEEGRLLRLLK… |
| A0A3L6MW42 | 1-332 | None |
| W9Y6B0 | 1-481 | None |
| A0A1B8FH58 | 110-482 | None |
| A0A0U5GCP4 | 1-334 | None |
| A0A0U5CBS1 | 13-379 | None |
| A0A0A2IXF1 | 67-409 | None |
| A0A0G4P3E5 | 146-571 | None |
| A0A1L9NKJ7 | 83-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.