DPCstruct | MC20911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 169 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9R5N6 | 105-259 | VVINSIRKEYIRLAQKQLNLYFALDKYFNKQENNMENVRESLRTKINSEHQNVIENDLEYSFAVGQALAYLQSKSKAKNKTQDIINQ… |
| M1ZX25 | 15-176 | SLIKGSIENGYIFKAGEQFNLRCALKEYFVGGESMADVLLDVKASLRDKVSREKTASIDNDKEYYFAVGQLASFLISLSKAAKKTHS… |
| R7ND99 | 1-164 | None |
| A0A7X9E285 | 299-490 | None |
| U7UI75 | 163-318 | None |
| A0A6M6DYT4 | 434-616 | None |
| B1IP20 | 437-620 | None |
| A0A448M7A6 | 48-238 | None |
| E9RX42 | 205-374 | None |
| A0A6N6SKW8 | 231-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.