DPCstruct | MC2091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 13.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C8XK19 | 1-111 | MPEAATPAIPPDVWGDRELQQALIERDFGVLCLRVRELTSMRQDDLALLAGLSQPYLSMLESGQRRLTNIDRIVALLDGMDVPVVLT… |
| A0A7T8ZI82 | 1-97 | MERRAGWVSRVPESLWSRPEVVAALRARDIAGLLALIRRHAGCSQNDLAGVTGIAQGRISEYMRGRRLPTLDTIERIADGVDMPPEG… |
| A0A3L8RFP0 | 33-130 | None |
| A0A5N8W8A8 | 1-91 | None |
| A0A101V428 | 2-87 | None |
| A0A850JIY8 | 1-125 | None |
| A0A1H4QAA6 | 45-145 | None |
| A0A563EJC8 | 55-151 | None |
| A0A1C5H344 | 4-95 | None |
| A0A1V2IMQ9 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.