DPCstruct | MC20908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 59.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8Y3K5 | 140-284 | RVAPAEKFEALILAESMVSIKGEGWLIGQINLPNVQDPIPADRCLLLVLESSRVEVAVLLNELAYSKYEASKSSSSTAETIISKQQK… |
| A0A446VSG4 | 5-128 | LGENWLSEDHKILDNKNAISVDKFVLLVLQSARVEVAVLLNELAFSKYESSKSSQIDDAIIQKQRNLAILFSLMERIIKMISDASSG… |
| A0A4S4DA55 | 270-414 | None |
| A0A2H9ZW14 | 72-205 | None |
| A0A453PXC7 | 123-244 | None |
| A0A0D9VM78 | 116-255 | None |
| A0A453PWW1 | 69-208 | None |
| A0A4Y7KRH4 | 197-339 | None |
| D7TXL9 | 24-145 | None |
| A0A2P2L991 | 51-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.