DPCstruct | MC20901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5UT15 | 3-81 | EYMSIVFIQNEEAEEPLNILEAQGKGAALQYLRQWDYGEDDGETYPENPAGSGDSTYREGNYIMSYNSSMGYIGLCKII |
| X0WAJ5 | 1-79 | MLIEHIIFLQDNEAIIPLDMIASHGKEEAIEYLQQWDFGGGERFNYSCWGKGDITYNQGDLILAYNALCGYISLYRKLG |
| A0A839R387 | 122-213 | None |
| A0A3G5T413 | 139-234 | None |
| A0A1M6GAQ2 | 125-222 | None |
| A0A7Y9I8W2 | 112-213 | None |
| A0A842UM01 | 205-293 | None |
| A0A1W2BN28 | 139-236 | None |
| A0A7T2TGX7 | 28-114 | None |
| A0A4V1D3F0 | 4-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.