DPCstruct | MC209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 121 ± 14 aa |
| Standard deviation of domain lengths | 14.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A095SQ76 | 51-150 | ADEVYTSVISDEDRVNSKGKALNNLTGFLIQDRANFHRFDKIDEDDDPDEIFTTPEARSRMPAMINAGYLDPDVESKSRTKNRTVGV… |
| A0A317PV82 | 78-191 | SGNPADDNDEIIGAYSAVIGEDDLYNSSGKRLTAPWQVLRQDRANFHRYGISQPGDEDDPFFGSADNRAAMESLLQNGDIDQSTARA… |
| A0A847DPY7 | 261-373 | None |
| A0A3M1CBT9 | 1-86 | None |
| A0A2V5R358 | 181-305 | None |
| A0A2E7ZVX7 | 281-412 | None |
| A0A5D0RAB3 | 44-184 | None |
| A0A366HRA0 | 249-393 | None |
| A0A218PMY7 | 10-119 | None |
| A0A0M4T386 | 4-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.