DPCstruct | MC20898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 194 ± 23 aa |
| Standard deviation of domain lengths | 22.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1WU92 | 1-192 | AEVRLAQQLAPALAAMCEQCDAELFMVLPRIVWLRFLVNPEEQAEFLGDILPHRFALSKPQEGDEPIAKPQRCLDPEVLCLLERFQE… |
| A0A7S4VBM2 | 339-534 | DWERAWVLGRRWLSNPRVCSGLCKVVAEVKAAQSYVPGLEEVCVSCDAELFMILPRIVLVCFLVAPSAHAEFMHVHFAHRIALPPPE… |
| A0A7S1S5K6 | 1-208 | None |
| A0A7S2KZ11 | 5-153 | None |
| A0A7S1WGQ8 | 197-421 | None |
| A0A812YY05 | 48-247 | None |
| A0A812M3L3 | 89-278 | None |
| A0A7S1QUY1 | 130-350 | None |
| A0A7S1AG59 | 145-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.