DPCstruct | MC20894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 219 ± 64 aa |
| Standard deviation of domain lengths | 63.63 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 67.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.23 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813JIL1 | 101-318 | SSSASLFDCKVVPADWEAVWPVEKMAYCCKNFSVGCVTFHCDVDSDDWGEDWSQLKKDWCCRVKQVGCMPATAGATPVEDACHSSCK… |
| A0A7S1WIP9 | 44-250 | SHKQKAFCCKYTQRGCFDCTEGRASWQRWPPKKKAHCCKKPGVCPNPHTTSLPFDCNNGFDHWATAWSVPKRVYCCLNARRGCPTPP… |
| A0A7S0AAU0 | 30-250 | None |
| A0A7S0A4X4 | 117-430 | None |
| A0A7S0A0D6 | 224-562 | None |
| A0A813F4Q8 | 150-329 | None |
| A0A1Q9E584 | 327-487 | None |
| A0A812QMH6 | 121-373 | None |
| A0A812XN51 | 213-479 | None |
| A0A7S2KT18 | 35-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.