DPCstruct | MC20892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 266 ± 38 aa |
| Standard deviation of domain lengths | 37.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 95.92 |
| Assigned Pfam label(s) | CL0168- CL0672- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3HP96 | 126-400 | FTNLGATGRLGPTSVGKYYDGQDHQGKVTLVNGTQFFTIPVSGLYRIRAAGAAGGCDNGRCHDRSHGAVVAGTFNLKAGRQLKILVG… |
| A2EY31 | 33-256 | CSSSIQTCTPYVVSLSRGTYQLELFGASGGFPNNDPKLGGHGSYTKGNLVVDHDMKLYVYLGQQGKLNGPRTFNGGGRGSANAGSGG… |
| T1PHZ5 | 164-474 | None |
| A0A518VAL6 | 13-287 | None |
| A2DIP6 | 8-224 | None |
| A2DRN8 | 20-282 | None |
| A2DX38 | 22-277 | None |
| A2F5G1 | 32-255 | None |
| A2FID4 | 4-248 | None |
| A2FD39 | 11-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.