DPCstruct | MC20890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 421 ± 93 aa |
| Standard deviation of domain lengths | 93.03 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P9HKR3 | 24-365 | KCVFQVVLVFGIHFWMFFILPGVTERRFNRNPIAQLWYFVKCIYFGLSAYQIKCGYPNRILGNFLTKNYNYLNLFLFQGFRMVPFLT… |
| A2EK50 | 27-401 | AISFFYCQNDISYMPGSLIFYLIVRLISHFCYSFHVRYGKTVLDFVYPDFKRDVHAIFSKNMSLKRIPLIFEIKSLFHWMSQDTYVK… |
| A0A821IUN5 | 72-405 | None |
| A0A653DHE2 | 769-1246 | None |
| A0A044T179 | 1088-1537 | None |
| A0A0R3QQZ3 | 92-474 | None |
| E7FD74 | 1898-2428 | None |
| A0A7S4PQ97 | 2-423 | None |
| A0A067RJC4 | 315-759 | None |
| A0A7F8K7I5 | 214-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.