DPCstruct | MC2089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05247 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E1NR30 | 1-83 | MSTSELLKHIYDINLSYLLLAQRLINDEKASAMFRLGITDTMADALSQLTLPQMVKLAETNQLVCHFRFSDHNTIHHLTNRVS |
| A0A653IC12 | 41-138 | MKSTRLLDEIRETNLSYLLLAQQLIREDRAEATFRLGISDEVAELIDQLTTAQVLRIASSNMLMCRFRFDDEVVWNLLTSHTKDRSV… |
| A0A7Y7J4A7 | 33-129 | None |
| A0A4P7L8D4 | 24-120 | None |
| F4GVS6 | 2-91 | None |
| A0A0L0LX68 | 1-89 | None |
| A0A840FUQ8 | 2-106 | None |
| A0A094IYN4 | 2-98 | None |
| A0A6B2FGH4 | 2-103 | None |
| A0A2Z5MFG4 | 62-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.