DPCstruct | MC20886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 164 |
|---|---|
| Mean domain length (aa) | 131 ± 20 aa |
| Standard deviation of domain lengths | 20.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7P6Y5 | 378-494 | FDYKNTAQVFNVIVSGYYKLQVWGAQGGYRSSATYSGLGGYSYGTVYLNAGDKVYVHTGGAGGSGTSGCGSTICAGGYNGGGYRYKY… |
| A2EAG7 | 29-148 | CELTSFECTSYYVDLNPGSFLFEAWGSVGSKWFEELHPEVPPSIPGQGSYTSGILNISKKLRLYLFIGANSYFNNVKENLTQSLKGC… |
| C3ZKD4 | 183-301 | None |
| C3ZKD2 | 88-232 | None |
| A0A4R1R5L2 | 456-604 | None |
| A0A1M6WXR7 | 38-161 | None |
| R6H5E6 | 149-318 | None |
| A0A4R7ST92 | 52-162 | None |
| A0A7I6Y693 | 2-124 | None |
| A2DRN8 | 17-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.