DPCstruct | MC2088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 17.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7JEN9 | 202-360 | RPPHHIKDFGRMCFGGEPFGRAAEYTGPGPHPVAVFLGTDSEDSYPEHTAGFAESDERWPPATELQLVACARLVGTNDSGSKSCSYS… |
| A0A853MWU5 | 22-174 | QDRTAQSASDFSSVCDNDHITNAAEYGKPYNIAAFFKGLTFMDESWLPVSSDKWSTSDRYSEINVVACLDRKKGSEVKATSCVDDDD… |
| A0A4R6WBC0 | 15-189 | None |
| A0A1M7RMP5 | 378-558 | None |
| A0A2M8Q2U9 | 100-242 | None |
| A0A559UTC4 | 515-661 | None |
| A0A223SCU5 | 202-379 | None |
| A0A2N2H3L0 | 215-342 | None |
| A0A7W7CD07 | 324-470 | None |
| A0A3A8UHC8 | 286-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.