DPCstruct | MC20879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 430 ± 67 aa |
| Standard deviation of domain lengths | 66.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9QNF0 | 410-885 | SNQQAILFSLGILHSRQLRQRLVETYQLDQRAVRQHVSIDIEVPRPLFAQRDREQTIYFPVLMPVKSKFQDDFSVHGPDGAALHVLP… |
| A0A147E5M8 | 2-359 | IIPLAFIAKDALRHFDARDGAGKSMPVLRSDEIARYQLAMLEYMFKVDGVDLEDGWKDSLRDLVGSGESVSDSDRMVALFEKGEWKG… |
| R7CKI0 | 111-606 | None |
| A0A1Y5XLH3 | 2-427 | None |
| D3PVB0 | 99-603 | None |
| A0A413DSZ3 | 184-664 | None |
| A0A6M5FBW5 | 47-495 | None |
| A0A1M4S012 | 1-423 | None |
| A0A0A0C500 | 44-534 | None |
| A0A0N0TLC5 | 5-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.