DPCstruct | MC20876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 196 ± 21 aa |
| Standard deviation of domain lengths | 21.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7HUS2 | 26-197 | ATKINDWLHSLSYSPPKLIEQIANDAGMSETGKRLFYRYEPKLLSEAEIEDQCGFGEIVLGCFTNDGIFIVDFNSVDEYKRTLVTAA… |
| A0A258BRQ7 | 17-191 | EPTSEMAQVASRSGLSKTGVFYLYAANPALVGAEKFNVNCQRAEQSSPILGCYNPSSNTVHIYDIDSDELDGIKEVTAAHEMLHVVY… |
| A0A2V4PXV0 | 19-241 | None |
| A0A5S4UVD8 | 35-213 | None |
| A0A521Z7D6 | 6-205 | None |
| F6FRP1 | 52-283 | None |
| A0A1H1MYG8 | 73-258 | None |
| A0A7T9DLD1 | 82-253 | None |
| A0A0Q5HN44 | 32-232 | None |
| A0A1G2FQM5 | 16-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.