DPCstruct | MC20872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 265 ± 45 aa |
| Standard deviation of domain lengths | 44.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174T687 | 65-321 | YFMTIHPDGSFKIEALKRNLFTMTEYDKYMDYFGLNEENKNDYRGVIGLVKDAEGNINLIKDTNMYSMPDYTAMGDVLKNVASEGRF… |
| A0A1Y3XSY2 | 229-474 | VYSDGILEYSQWEEELFWQDDEQEKIARAFQDDRGKVDPHVEGLVYQDPDNIHVIRKTDRYTLPEITLLQELLARTPNGEQLSVEPL… |
| B0ACT2 | 418-691 | None |
| A0A2M7NG61 | 247-528 | None |
| A0A7J5LQG1 | 327-704 | None |
| A0A1Y3RUY4 | 8-244 | None |
| A0A655WA28 | 10-233 | None |
| A0A1Z5J099 | 3-205 | None |
| A0A1Z8A7Z2 | 496-824 | None |
| K6Q190 | 16-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.