DPCstruct | MC20871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1962 |
|---|---|
| Mean domain length (aa) | 136 ± 32 aa |
| Standard deviation of domain lengths | 32.35 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 49.53 |
| Assigned Pfam label(s) | PF05593- PF20551- CL0159- PF03527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6BGU1 | 18-186 | FTYDALGLISRIVDWTGTTNVERDSLGQIEKITDPKNRTVGYTYGSSGERTSITYPDGKRVDYLYDNMTRLSAIVDGANKTLYDYDE… |
| A0A174SQ23 | 21-157 | IWYCYDSQANLIFVTIRGITYFYVRNVQGDIIALVDADGKVVVKYTSDSWGKVIAVTGELADTVGVQNPFRYKGYYYDNETGMYYLK… |
| A0A2D2D816 | 7-120 | None |
| A0A1V5ZDA4 | 7-95 | None |
| A0A1V5Z7D6 | 125-302 | None |
| A0A486XQH0 | 49-215 | None |
| A0A511NJK5 | 32-186 | None |
| A0A486XK96 | 45-186 | None |
| A0A1G2YEV5 | 1-72 | None |
| A0A330MFB3 | 6-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.